C1orf103 Antibody - middle region : Biotin

C1orf103 Antibody - middle region : Biotin
Artikelnummer
AVIARP56174_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf103

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ligand-dependent nuclear receptor-interacting factor 1

Protein Size: 769

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56174_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56174_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55791
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×