C1orf103 Antibody - N-terminal region : HRP

C1orf103 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56173_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf103

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ligand-dependent nuclear receptor-interacting factor 1

Protein Size: 233

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56173_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56173_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55791
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×