C1orf144 Antibody - N-terminal region : Biotin

C1orf144 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55304_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf144

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SUZ domain-containing protein 1

Protein Size: 133

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55304_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55304_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 26099
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×