C1orf43 Antibody - middle region : FITC

C1orf43 Antibody - middle region : FITC
Artikelnummer
AVIARP54537_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf43

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: YQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C1orf43

Protein Size: 253

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54537_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54537_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25912
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×