C20orf10 Antibody - middle region : Biotin

C20orf10 Antibody - middle region : Biotin
Artikelnummer
AVIARP53699_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of C20orf10 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C20orf10

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: TSLAAMPRKEKHIEPEVPRTSRDDSLNPGVQGRQPLTEGPRVIFIKPYRN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TP53-target gene 5 protein

Protein Size: 290

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53699_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53699_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27296
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×