C20orf132 Antibody - middle region : Biotin

C20orf132 Antibody - middle region : Biotin
Artikelnummer
AVIARP53528_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C20orf132

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C20orf132

Protein Size: 573

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53528_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53528_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 140699
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×