C22orf28 Antibody - N-terminal region : Biotin

C22orf28 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56745_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C22orf28

Key Reference: Guo,D., (2005) Biochem. Biophys. Res. Commun. 337 (4), 1308-1318

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tRNA-splicing ligase RtcB homolog

Protein Size: 505

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56745_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56745_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 51493
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×