C22orf31 Antibody - N-terminal region : Biotin

C22orf31 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57990_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C22orf31

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: ASSFSLVKLVLRRQLKNKCCPPPCKFGEGKLSKRLKHKDDSVMKATQQAR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C22orf31

Protein Size: 290

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57990_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57990_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25770
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×