C22orf9 Antibody - middle region : FITC

C22orf9 Antibody - middle region : FITC
Artikelnummer
AVIARP55213_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of C22orf9 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C22orf9

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: ERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein KIAA0930

Protein Size: 409

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55213_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55213_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23313
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×