C2orf25 Antibody - middle region : Biotin

C2orf25 Antibody - middle region : Biotin
Artikelnummer
AVIARP55333_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of C2orf25 remains unknown.Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism (Coelho et al., 2008 [PubMed 18385497]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C2orf25

Key Reference: Coelho,D., (2008) N. Engl. J. Med. 358 (14), 1454-1464

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Methylmalonic aciduria and homocystinuria type D protein, mitochondrial

Protein Size: 296

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55333_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55333_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27249
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×