C2orf25 Antibody - N-terminal region : FITC

C2orf25 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55332_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of C2orf25 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf25

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Methylmalonic aciduria and homocystinuria type D protein, mitochondrial

Protein Size: 296

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55332_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55332_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27249
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×