C2orf29 Antibody - middle region : Biotin

C2orf29 Antibody - middle region : Biotin
Artikelnummer
AVIARP56972_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C2orf29

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UPF0760 protein C2orf29

Protein Size: 510

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56972_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56972_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55571
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×