C2orf42 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of C2orf42 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf42

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: ITRSFIQNRDGTYELFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C2orf42

Protein Size: 574

Purification: Affinity Purified

• Artikelnummer: AVIARP53727_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53727_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54980
• Wirt: Rabbit
• Konjugat: Conjugated, FITC