C2orf42 Antibody - N-terminal region : FITC

C2orf42 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP53726_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of C2orf42 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf42

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: EPNSLRTKVPAFLSDLGKATLRGIRKCPRCGTYNGTRGLSCKNKTCGTIF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C2orf42

Protein Size: 574

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53726_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53726_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54980
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×