Uniprot: P01024
Gene Name: C3
Immunogen: Recombinant human C3
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 86%
Core Sequence: DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLE
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 86%, Rat - 90%, Pig - 89%, Cynomolgus monkey - 94%
Alternative gene names: CPAMD1
Alternative protein names: Complement C3; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1) [Cleaved into: Complement C3 beta chain; C3-beta-c; C3bc; Complement C3 alpha chain; C3a anaphylatoxin; Acylation stimulating protein; ASP; C3adesArg; Complement C3b alpha' chain; Complement C3c alpha' chain fragment 1; Complement C3dg fragment; Complement C3g fragment; Complement C3d fragment; Complement C3f fragment; Complement C3c alpha' chain fragment 2]
Protein name: Complement C3
Clone No.: K70031_8B8
Antigen Species: Human
Target Name: C3
IHC Verification: -
IHC Dilution: N/A
WB Verification: Fail (Hep G2)
WB Dilution: N/A
IP Verification: Fail (Plasma(SH191-200P))
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: succeed
Sandwich ELISA Dilution: 1:250~1:500
Antigen ID: PP-055
Cross reactivity: Not tested
Deutsch
English
