C3orf49 Antibody - middle region : FITC

C3orf49 Antibody - middle region : FITC
Artikelnummer
AVIARP53537_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C3orf49

Molecular Weight: 33

Peptide Sequence: Synthetic peptide located within the following region: IQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative uncharacterized protein C3orf49

Protein Size: 292

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53537_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53537_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 132200
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×