C4orf20 Antibody - middle region : FITC

C4orf20 Antibody - middle region : FITC
Artikelnummer
AVIARP57217_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C4orf20

Key Reference: 0

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: YHHYMQDRIDDNGWGCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ufm1-specific protease 2

Protein Size: 469

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57217_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57217_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55325
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×