C5orf36 Antibody - N-terminal region : HRP

C5orf36 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55682_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of C5orf36 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C5orf36

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein KIAA0825

Protein Size: 324

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55682_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55682_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 285600
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×