C5orf39 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: C5orf39 may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C5orf39

Key Reference: Lu,G., (2006) J. Biol. Chem. 281 (41), 30542-30550

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Annexin-2 receptor

Protein Size: 193

Purification: Affinity Purified

• Artikelnummer: AVIARP54435_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54435_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 389289
• Wirt: Rabbit
• Konjugat: Conjugated, HRP