C6orf146 Antibody - middle region : Biotin

C6orf146 Antibody - middle region : Biotin
Artikelnummer
AVIARP55647_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of C6orf146 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf146

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM217A

Protein Size: 508

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55647_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55647_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 222826
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×