C6orf146 Antibody - middle region : HRP

C6orf146 Antibody - middle region : HRP
Artikelnummer
AVIARP55647_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of C6orf146 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf146

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM217A

Protein Size: 508

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55647_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55647_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 222826
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×