C6orf154 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf154

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Leucine-rich repeat-containing protein 73

Protein Size: 316

Purification: Affinity Purified

• Artikelnummer: AVIARP54422_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54422_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 221424
• Wirt: Rabbit
• Konjugat: Conjugated, HRP