C6orf173 Antibody - N-terminal region : HRP

C6orf173 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54417_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: C6orf173 is up-regulated in many cancer tissues. It suggests that C6orf173 may act as an oncogene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf173

Key Reference: Lee,S., (2007) Biochem. Biophys. Res. Commun. 360 (3), 633-639

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Centromere protein W

Protein Size: 88

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54417_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54417_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 387103
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×