C7orf38 Antibody - middle region : FITC

C7orf38 Antibody - middle region : FITC
Artikelnummer
AVIARP55465_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of this protein remains unknown. The protein is weakly similar to transposase-like proteins in human and mouse.This gene encodes a protein of unknown function. The protein is weakly similar to transposase-like proteins in human and mouse.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C7orf38

Key Reference: Thompson,E.E., (2006) Pharmacogenomics J. 6 (2), 105-114

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM200A

Protein Size: 573

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55465_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55465_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221786
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×