C7orf43 Antibody - middle region : FITC

C7orf43 Antibody - middle region : FITC
Artikelnummer
AVIARP57190_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C7orf43

Key Reference: 0

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: DLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C7orf43

Protein Size: 580

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57190_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57190_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55262
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×