C7orf61 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: SSQVRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHRRHHVRCH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C7orf61

Protein Size: 206

Purification: Affinity Purified

• Artikelnummer: AVIARP54387_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54387_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Guinea Pig
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 402573
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin