C7orf61 Antibody - C-terminal region : FITC

C7orf61 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54388_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of LOC402573 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LOC402573

Key Reference: Scherer,S.W., (2003) Science 300 (5620), 767-772

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: YLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C7orf61

Protein Size: 206

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54388_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54388_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 402573
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×