C7orf61 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of LOC402573 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LOC402573

Key Reference: Scherer,S.W., (2003) Science 300 (5620), 767-772

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: YLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein C7orf61

Protein Size: 206

Purification: Affinity Purified

• Artikelnummer: AVIARP54388_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54388_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 402573
• Wirt: Rabbit
• Konjugat: Conjugated, HRP