C9orf153 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of C9orf153 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf153

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: NEAQEVLARNLNVMSFTRGADVRGDLQPVISVNKMNKPGKHRKTPSPKIN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C9orf153

Protein Size: 29

Purification: Affinity Purified

• Artikelnummer: AVIARP54403_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54403_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 389766
• Wirt: Rabbit
• Konjugat: Conjugated, FITC