C9orf68 Antibody - middle region : Biotin

C9orf68 Antibody - middle region : Biotin
Artikelnummer
AVIARP56259_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf68

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spermatogenesis associated 6-like protein

Protein Size: 392

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56259_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56259_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55064
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×