C9orf75 Antibody - middle region : FITC

C9orf75 Antibody - middle region : FITC
Artikelnummer
AVIARP55691_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of C9orf75 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf75

Key Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: PPFLPAASEEAEPAEGLRVPGLAKNSREYVRPGLPVTFIDEVDSEEAPQA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 650

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55691_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55691_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 286262
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×