C9orf75 Antibody - middle region : HRP

C9orf75 Antibody - middle region : HRP
Artikelnummer
AVIARP55692_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of C9orf75 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf75

Key Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDLSDFRSEPALY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 433

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55692_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55692_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 286262
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×