C9orf95 Antibody - N-terminal region : HRP

C9orf95 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57055_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of C9orf95 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C9orf95

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nicotinamide riboside kinase 1

Protein Size: 199

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57055_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57055_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54981
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×