CAB39 Antibody - middle region : FITC

CAB39 Antibody - middle region : FITC
Artikelnummer
AVIARP56877_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAB39

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium-binding protein 39

Protein Size: 341

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56877_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56877_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51719
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×