CAB39 Antibody - middle region : HRP

CAB39 Antibody - middle region : HRP
Artikelnummer
AVIARP56877_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAB39

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calcium-binding protein 39

Protein Size: 341

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56877_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56877_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51719
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×