CABYR Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Transcript variants of this gene encode multiple protein isoforms. An additional transcript and isoform has not been fully characterized.

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: SKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium-binding tyrosine phosphorylation-regulated protein

Protein Size: 221

Purification: Affinity Purified

• Artikelnummer: AVIARP53673_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53673_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26256
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin