CALR Antibody - N-terminal region : Biotin

CALR Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58123_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CALR

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: SSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calreticulin

Protein Size: 417

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58123_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58123_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 811
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×