Camk2b Antibody - middle region : HRP

Camk2b Antibody - middle region : HRP
Artikelnummer
AVIARP55353_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Camk2b is a beta subunit of calcium/calmodulin-dependent protein kinase II; It may be involved in retinal development,

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Camk2b

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calcium/calmodulin-dependent protein kinase II, beta 3 isoform EMBL CAA58289.1

Protein Size: 589

Purification: Affinity Purified

Subunit: beta
Mehr Informationen
Artikelnummer AVIARP55353_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55353_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 24245
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×