CARD8 Antibody - N-terminal region : Biotin

CARD8 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55119_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CARD8

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase recruitment domain-containing protein 8

Protein Size: 286

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55119_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55119_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22900
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×