CASS4 Antibody - N-terminal region : HRP

CASS4 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57390_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CASS4 is a docking protein that plays a role in tyrosine kinase-based signaling related to cell adhesion and cell spreading. It regulates PTK2/FAK1 activity, focal adhesion integrity, and cell spreading.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CASS4

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cas scaffolding protein family member 4

Protein Size: 349

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57390_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57390_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57091
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×