CCDC181 Antibody - N-terminal region : Biotin

CCDC181 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57521_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CC181

Key Reference: N/A

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: SPRRNDIISVPGIQPLDPISDSDSENSFQESKLESQKDLEEEEDEEVRRY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: coiled-coil domain-containing protein 181

Protein Size: 509

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP57521_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57521_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57821
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×