CCDC184 Antibody - middle region : Biotin

CCDC184 Antibody - middle region : Biotin
Artikelnummer
AVIARP54427_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC387856

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: LQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: coiled-coil domain-containing protein 184

Protein Size: 194

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54427_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54427_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 387856
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×