CCDC197 Antibody - N-terminal region : HRP

CCDC197 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55545_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf48

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: uncharacterized protein CCDC197; putative uncharacterized protein CCDC197

Protein Size: 140

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55545_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55545_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 256369
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×