CCDC28A Antibody - middle region : Biotin

CCDC28A Antibody - middle region : Biotin
Artikelnummer
AVIARP55253_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is located in a region close to the locus of the pseudogene of chemokine (C-C motif) receptor-like 1 on chromosome 6. The specific function of this gene has not yet been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC28A

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: ERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 28A

Protein Size: 274

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55253_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55253_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25901
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×