CCDC46 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of the gene exist in mouse, rat and chimp.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCDC46

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centrosomal protein of 112 kDa

Protein Size: 211

Purification: Affinity Purified

• Artikelnummer: AVIARP53824_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53824_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 201134
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin