CCDC69 Antibody - middle region : HRP

CCDC69 Antibody - middle region : HRP
Artikelnummer
AVIARP55307_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of CCDC69 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC69

Key Reference: Suzuki,Y., Gene 200 (1-2), 149-156 (1997)

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Coiled-coil domain-containing protein 69

Protein Size: 296

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55307_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55307_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26112
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×