CCDC7 Antibody - N-terminal region : FITC

CCDC7 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54463_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of CCDC7 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC7

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 7

Protein Size: 486

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54463_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54463_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221016
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×