CCDC70 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of CCDC70 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC70

Key Reference: Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: TFRGKIHAFRGQILGFWEEERPFWEEEKTFWKEEKSFWEMEKSFREEEKT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 70

Protein Size: 233

Purification: Affinity Purified

• Artikelnummer: AVIARP53804_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53804_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 83446
• Wirt: Rabbit
• Konjugat: Conjugated, FITC