CCDC76 Antibody - N-terminal region : FITC

CCDC76 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57327_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CCDC76 specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signature.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC76

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tRNA guanosine-2'-O-methyltransferase TRM13 homolog

Protein Size: 481

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57327_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57327_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54482
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×