CCDC87 Antibody - N-terminal region : Biotin

CCDC87 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57157_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC87

Key Reference: 0

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 87

Protein Size: 849

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57157_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57157_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55231
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×